Chevrolet Sonic manuals

Chevrolet Sonic Repair Manual: Front Fog Lamp Package Installation

Chevrolet Sonic Repair Manual / Electrical / General / Front Fog Lamp Package Installation

Installation Instructions Part Number

95950443

















d2.50.5nm(220.5nmlbin)















d2.5nm(22lbin)(220.5nmlbin)











<aiiregionsexceptgmna,southamericaandaustraia>https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2web1.request\/.c.iwithvcapfileregionaltac(technicalcenter)orhelpdesk2.\/.c.i(vehicleconfigurationindex)

https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2webhttps://wvvw.autopartners.net/apps/gcportalpmglammlllgbyvcivclbebyyou234567890normal:gmna,southamericaandaustraliavci:allregionsexceptgmna,southamericaandaustralia

7600mm(7.6m)
BCM Programming

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicle Configuration Index

    Note:

    Steps 1 to 9 are for all regions except GMNA, South America and Australia.

  1. Request V.C.I (Vehicle Configuration Index) for correct BCM reprogram with Front Fog Lamp Variant.
  2. serviceprogrammingsystemsupportedcontrollersselectcontrolleroyonrooueepselectricpowersteeringcontrolmoduleebcmelectronicbrakecontrolmoduleecmenginecontrolmodulehvsm_ffrontseatheatingcontrolmodulefscmfuelpumpcontrolmoduleimmoimmobilizerlearnsdminatablerestraintsensinganddiagnosticmoduleipcinstrumentclusterselectfunctionsequenceselectprogrammingtypevm:kl1tf4639cb00o395ecudata<backcancel

    Note:

    Obtain VCAP file about T300 vehicle which Front Fog Lamp is installed newly.

  3. Select “VCAP” in Select Controller menu in TIS2Web and click “Next”.
  4. serviceprogrammingsystemvgapconfigcurr-ecusoftwareselectecucongurationsetup1360085210002617congurationsetupfunconsvehicledatasales/makeopelmodelyear2010modelinsigniaengine2.0llbovin:wolgm8ekra1012345
  5. Select “Next”.
  6. senliceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonwidecaptureofecuidenticationdataspecialfunctionsessionlogm4382:connectingtothesewer...vin:kl1tf4839cb000395
  7. Check “Vehicle wide Capture of ECU Identification Data” and click “Next”.
  8. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007o95422og.xmpressnexttostarttheproceduralprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  9. The path and filename is set automatically. Click “Next”.
  10. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007095422log.xmpleasewait...progressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  11. Now the function is running.
  12. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\bzybty\documents\kl1tf4639cb000395_20110119153344iog.csvsucessfullycompleted,pressfinishlprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  13. After the message “Successfully completed, press finish” comes up, click “Finish”. The created XML file (see path) Dealer to send responsible Technical Assistance Center (or Help desk).
  14. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_20110o7095422log.xmsucessfullycompleted,pressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  15. Click “Finish”.
  16. serviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonvehiclewidecaptureofecuidentificationdataspecialfunctionsessionlogvehiclewidecaptureofecuidentificationdata
  17. Click “Finish” to end the function.
BCM Reprogram


    Select Diagnostic Tool, Programming Process and click “Next”.serviceprogrammingsystemselectdiagnostictoolandprogrammingprocessselectdiagnostictoolj2534tech2j2534scan100j2534vectorpassthruxlubrarytech2legacypass-thrutech2remotetestdriverselectprogrammingprocess
  1. Select Diagnostic Tool, Programming Process and click “Next”.
  2. serviceprogrammingsystemj2534passthru:connectj2534devicetovehicleandpc:verifyvehiclebatteryfullycharged,engineoff,ignitionon.connectj2534devicetovehicle.connectj2534devicetopc.switchj2534deviceonandwaitfordevicetogetready.afterprogramming,thetechnicianwillbegiventheopportunitytocleardiagnostictroublecodesfromallecusonthisvehicle.thetechnicianmaywanttorecorddtcsandfreezeframedatabeforecontinuing.
  3. Click “Next”.
  4. serviceprogrammingsystemvalidate/selectvehicledatasalesmakechevroletvehicletypepassengergarserviceprogrammingsystemm4387:communicatingwiththedevice,pleasewait.
  5. Select Salesmake, Model Year, Vehicle Type, Car Line and click “Next”.
  6. serviceprogrammingsystemvalidatevehicleidentificationnumber(vin)makesurethatthecorrectvinisdisplayed.ifthevinisincorrectormissing,enterthevin.eumu-nrkl3ta48e9cboo2255upcomm:arrrnsnumsruninsunrun
  7. Verify correct VIN, click “Next”.
  8. serviceprogrammingsystemsupportedcontrollersselectcontrollerecuidentificationdatacontrolmoduleelectronicbrakecontrolmoduleenginecontrolmodulefrontseatheatingcontrolmodulefuelpumpcontrolmoduleimmobilizerlearninatablerestraintsensinganddiagnosticmoduleinstrumentclusterselectfunctionsequenceonrgurationsetuppreparecontrolmoduleforremovalselectprogrammingtypevin:kl3ta48e9cb002255data
  9. Select BCM in Controller and Programming in Function/Sequence.
  10. Select Programming Type.
  • “Normal” - (GMNA, South America & Australia)
  • “VCI” - (All Regions Except GMNA, South America and Australia)
Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA,serviceprogrammingsystemprogrammingbyvcientervalidvcinumberforthisvehicle.thevcimustbesuppliedbythecustomersupportcenter,andisonlyvalidforthisvin.donotentervciyouusedpreviouslyforanothervehicle.1234567890vin:kl3ta48e9cboo2255
  • Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA, South America and Australia) click “Next”.
  • serviceprogrammingsystemecusoftwareseectecusoftware35796891358262295932574959325989593260795474793959326329517403495932662959326749549036095932688954903919523369895040050vehicledatasalesmakeholdenmodelyear2012modelbarinaenine1.6llde
  • Confirm the ECU Software in TIS2WEB and Click “Next”.
  • serviceprogrammingsystemtransferdata1.downloadfromsewer2.loadtoecudownloadfromserverserverdownloadstatusestimatedtimeremainingdownload00meted0%loadecustatusestimatedtimeremainingfteprogramming...00:00:380%m4382:connectingtothesewer...vin:wolgb57h4910oob82
  • Programming in progress.
  • serviceprogrammingsystemj2534passthru:finalinstructionsprogrammingcomplete.warrantyclaimcode:40d7brecordthiscodeonthewarrantyrepairorder(ifapplicable).postprogramminginstructions:followthecontrollerspecificinstructionsbelow.iftherearenocontrollerspecificinstructions,turnignitionofffor30secondstoresetthecontroller.controllerspecificinstructions:clearingdtcswillerasestoredhistorydatafromallcontrollers,andwillresetthepcmi/mflags.pleaseperform:bodycontrolmoduleconfigurationsetupvin:wolgb57h491000882cleardtcscancel
  • Programming Complete.

    Note:

    After reprogramming the BCM, it may not recognize the brake pedal application & position. Delete all stored DTC’s after the reprogramming.

    Note:

    If the BAS Learning is not correctly completed; MDI GDS: Diagnostic>BCM>Reset Functions>”Brake Pedal Position Sensor Learn”.

  • Support Process


      Request BCM V.C.I by E-mail to regional TAC or other Help desk.tac/helpdesksupportdependson
    Electrical Power Management Description and Operation
    Electrical Power Management The electrical power management is used to monitor and control the charging system and alert the driver of possible problems within the charging system. The ...

    Generator Pulley Replacement (LUV)
    Generator Pulley Replacement Callout Component Name Preliminary Procedure Remove the generator. Refer to Generator Replacement. ...

    Other materials:

    Rear Wheelhouse Liner Replacement (Hatchback - Right)
    Rear Wheelhouse Liner Replacement Callout Component Name Preliminary Procedure Remove the tire and wheel assembly. Refer to Tire and Wheel Removal and Installation. 1 Rear Wheelhouse Panel Liner ...

    Sunroof Housing Rear Drain Hose Replacement
    Sunroof Housing Rear Drain Hose Replacement Callout Component Name Preliminary Procedures It is only necessary to lower the headliner. Only do those steps in the headliner replacement procedure that will lower the headliner ...

    Engine Replacement (Manual Transmission)
    Special Tools J-45859 Wheel Drive Shaft Remover . CH-807 Closure Plugs .  For equivalent regional tools, refer to Special Tools. Removal Procedure Remove the battery and battery tray. Refer to Battery Tray Replacement. Relieve the fuel system pressure. Refer to ...

    © 2014-2019 Copyright www.csmans.com
       
    0.0135