Chevrolet Sonic manuals

Chevrolet Sonic Repair Manual: Front Fog Lamp Package Installation

Chevrolet Sonic Repair Manual / Electrical / General / Front Fog Lamp Package Installation

Installation Instructions Part Number

95950443

















d2.50.5nm(220.5nmlbin)















d2.5nm(22lbin)(220.5nmlbin)











<aiiregionsexceptgmna,southamericaandaustraia>https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2web1.request\/.c.iwithvcapfileregionaltac(technicalcenter)orhelpdesk2.\/.c.i(vehicleconfigurationindex)

https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2webhttps://wvvw.autopartners.net/apps/gcportalpmglammlllgbyvcivclbebyyou234567890normal:gmna,southamericaandaustraliavci:allregionsexceptgmna,southamericaandaustralia

7600mm(7.6m)
BCM Programming

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicle Configuration Index

    Note:

    Steps 1 to 9 are for all regions except GMNA, South America and Australia.

  1. Request V.C.I (Vehicle Configuration Index) for correct BCM reprogram with Front Fog Lamp Variant.
  2. serviceprogrammingsystemsupportedcontrollersselectcontrolleroyonrooueepselectricpowersteeringcontrolmoduleebcmelectronicbrakecontrolmoduleecmenginecontrolmodulehvsm_ffrontseatheatingcontrolmodulefscmfuelpumpcontrolmoduleimmoimmobilizerlearnsdminatablerestraintsensinganddiagnosticmoduleipcinstrumentclusterselectfunctionsequenceselectprogrammingtypevm:kl1tf4639cb00o395ecudata<backcancel

    Note:

    Obtain VCAP file about T300 vehicle which Front Fog Lamp is installed newly.

  3. Select “VCAP” in Select Controller menu in TIS2Web and click “Next”.
  4. serviceprogrammingsystemvgapconfigcurr-ecusoftwareselectecucongurationsetup1360085210002617congurationsetupfunconsvehicledatasales/makeopelmodelyear2010modelinsigniaengine2.0llbovin:wolgm8ekra1012345
  5. Select “Next”.
  6. senliceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonwidecaptureofecuidenticationdataspecialfunctionsessionlogm4382:connectingtothesewer...vin:kl1tf4839cb000395
  7. Check “Vehicle wide Capture of ECU Identification Data” and click “Next”.
  8. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007o95422og.xmpressnexttostarttheproceduralprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  9. The path and filename is set automatically. Click “Next”.
  10. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007095422log.xmpleasewait...progressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  11. Now the function is running.
  12. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\bzybty\documents\kl1tf4639cb000395_20110119153344iog.csvsucessfullycompleted,pressfinishlprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  13. After the message “Successfully completed, press finish” comes up, click “Finish”. The created XML file (see path) Dealer to send responsible Technical Assistance Center (or Help desk).
  14. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_20110o7095422log.xmsucessfullycompleted,pressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  15. Click “Finish”.
  16. serviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonvehiclewidecaptureofecuidentificationdataspecialfunctionsessionlogvehiclewidecaptureofecuidentificationdata
  17. Click “Finish” to end the function.
BCM Reprogram


    Select Diagnostic Tool, Programming Process and click “Next”.serviceprogrammingsystemselectdiagnostictoolandprogrammingprocessselectdiagnostictoolj2534tech2j2534scan100j2534vectorpassthruxlubrarytech2legacypass-thrutech2remotetestdriverselectprogrammingprocess
  1. Select Diagnostic Tool, Programming Process and click “Next”.
  2. serviceprogrammingsystemj2534passthru:connectj2534devicetovehicleandpc:verifyvehiclebatteryfullycharged,engineoff,ignitionon.connectj2534devicetovehicle.connectj2534devicetopc.switchj2534deviceonandwaitfordevicetogetready.afterprogramming,thetechnicianwillbegiventheopportunitytocleardiagnostictroublecodesfromallecusonthisvehicle.thetechnicianmaywanttorecorddtcsandfreezeframedatabeforecontinuing.
  3. Click “Next”.
  4. serviceprogrammingsystemvalidate/selectvehicledatasalesmakechevroletvehicletypepassengergarserviceprogrammingsystemm4387:communicatingwiththedevice,pleasewait.
  5. Select Salesmake, Model Year, Vehicle Type, Car Line and click “Next”.
  6. serviceprogrammingsystemvalidatevehicleidentificationnumber(vin)makesurethatthecorrectvinisdisplayed.ifthevinisincorrectormissing,enterthevin.eumu-nrkl3ta48e9cboo2255upcomm:arrrnsnumsruninsunrun
  7. Verify correct VIN, click “Next”.
  8. serviceprogrammingsystemsupportedcontrollersselectcontrollerecuidentificationdatacontrolmoduleelectronicbrakecontrolmoduleenginecontrolmodulefrontseatheatingcontrolmodulefuelpumpcontrolmoduleimmobilizerlearninatablerestraintsensinganddiagnosticmoduleinstrumentclusterselectfunctionsequenceonrgurationsetuppreparecontrolmoduleforremovalselectprogrammingtypevin:kl3ta48e9cb002255data
  9. Select BCM in Controller and Programming in Function/Sequence.
  10. Select Programming Type.
  • “Normal” - (GMNA, South America & Australia)
  • “VCI” - (All Regions Except GMNA, South America and Australia)
Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA,serviceprogrammingsystemprogrammingbyvcientervalidvcinumberforthisvehicle.thevcimustbesuppliedbythecustomersupportcenter,andisonlyvalidforthisvin.donotentervciyouusedpreviouslyforanothervehicle.1234567890vin:kl3ta48e9cboo2255
  • Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA, South America and Australia) click “Next”.
  • serviceprogrammingsystemecusoftwareseectecusoftware35796891358262295932574959325989593260795474793959326329517403495932662959326749549036095932688954903919523369895040050vehicledatasalesmakeholdenmodelyear2012modelbarinaenine1.6llde
  • Confirm the ECU Software in TIS2WEB and Click “Next”.
  • serviceprogrammingsystemtransferdata1.downloadfromsewer2.loadtoecudownloadfromserverserverdownloadstatusestimatedtimeremainingdownload00meted0%loadecustatusestimatedtimeremainingfteprogramming...00:00:380%m4382:connectingtothesewer...vin:wolgb57h4910oob82
  • Programming in progress.
  • serviceprogrammingsystemj2534passthru:finalinstructionsprogrammingcomplete.warrantyclaimcode:40d7brecordthiscodeonthewarrantyrepairorder(ifapplicable).postprogramminginstructions:followthecontrollerspecificinstructionsbelow.iftherearenocontrollerspecificinstructions,turnignitionofffor30secondstoresetthecontroller.controllerspecificinstructions:clearingdtcswillerasestoredhistorydatafromallcontrollers,andwillresetthepcmi/mflags.pleaseperform:bodycontrolmoduleconfigurationsetupvin:wolgb57h491000882cleardtcscancel
  • Programming Complete.

    Note:

    After reprogramming the BCM, it may not recognize the brake pedal application & position. Delete all stored DTC’s after the reprogramming.

    Note:

    If the BAS Learning is not correctly completed; MDI GDS: Diagnostic>BCM>Reset Functions>”Brake Pedal Position Sensor Learn”.

  • Support Process


      Request BCM V.C.I by E-mail to regional TAC or other Help desk.tac/helpdesksupportdependson
    Electrical Power Management Description and Operation
    Electrical Power Management The electrical power management is used to monitor and control the charging system and alert the driver of possible problems within the charging system. The ...

    Generator Pulley Replacement (LUV)
    Generator Pulley Replacement Callout Component Name Preliminary Procedure Remove the generator. Refer to Generator Replacement. ...

    Other materials:

    Input Speed Sensor Replacement
    Removal Procedure Remove the control solenoid valve and transmission control module assembly. Refer to Control Solenoid Valve and Transmission Control Module Assembly Replacement. Remove the input speed sensor bolt (2) M6 x 23. Unlock t ...

    Mirror Adjustment
    Exterior Mirrors Manual Outside Mirrors Move the control up, down, or side to side to adjust the mirror. See Manual Mirrors. Power Outside Mirrors For vehicles with power outside mirrors: 1. Select the mirror by moving the selector switch to L for the driver side or R for the passenger s ...

    Dome Lamps
    The dome lamp controls are in the headliner above the rear seats. (Dome Lamp Override): Press to turn the lamps off, even when a door is open. (Door): When the button is returned to the middle position, the lamps turn on automatically when a door is opened. | (On): Press to turn on the dom ...

    2014-2019 Copyright www.csmans.com