Chevrolet Sonic manuals

Chevrolet Sonic Repair Manual: Front Fog Lamp Package Installation

Chevrolet Sonic Repair Manual / Electrical / General / Front Fog Lamp Package Installation

Installation Instructions Part Number

95950443

















d2.50.5nm(220.5nmlbin)















d2.5nm(22lbin)(220.5nmlbin)











<aiiregionsexceptgmna,southamericaandaustraia>https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2web1.request\/.c.iwithvcapfileregionaltac(technicalcenter)orhelpdesk2.\/.c.i(vehicleconfigurationindex)

https://sporef.gm.com/weblogic/sporef/verifygpldacess?apppam=tis2webhttps://wvvw.autopartners.net/apps/gcportalpmglammlllgbyvcivclbebyyou234567890normal:gmna,southamericaandaustraliavci:allregionsexceptgmna,southamericaandaustralia

7600mm(7.6m)
BCM Programming

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicles are required to update the BCM programming through TIS2Web SPS

Vehicle Configuration Index

    Note:

    Steps 1 to 9 are for all regions except GMNA, South America and Australia.

  1. Request V.C.I (Vehicle Configuration Index) for correct BCM reprogram with Front Fog Lamp Variant.
  2. serviceprogrammingsystemsupportedcontrollersselectcontrolleroyonrooueepselectricpowersteeringcontrolmoduleebcmelectronicbrakecontrolmoduleecmenginecontrolmodulehvsm_ffrontseatheatingcontrolmodulefscmfuelpumpcontrolmoduleimmoimmobilizerlearnsdminatablerestraintsensinganddiagnosticmoduleipcinstrumentclusterselectfunctionsequenceselectprogrammingtypevm:kl1tf4639cb00o395ecudata<backcancel

    Note:

    Obtain VCAP file about T300 vehicle which Front Fog Lamp is installed newly.

  3. Select “VCAP” in Select Controller menu in TIS2Web and click “Next”.
  4. serviceprogrammingsystemvgapconfigcurr-ecusoftwareselectecucongurationsetup1360085210002617congurationsetupfunconsvehicledatasales/makeopelmodelyear2010modelinsigniaengine2.0llbovin:wolgm8ekra1012345
  5. Select “Next”.
  6. senliceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonwidecaptureofecuidenticationdataspecialfunctionsessionlogm4382:connectingtothesewer...vin:kl1tf4839cb000395
  7. Check “Vehicle wide Capture of ECU Identification Data” and click “Next”.
  8. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007o95422og.xmpressnexttostarttheproceduralprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  9. The path and filename is set automatically. Click “Next”.
  10. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureecuidentificationdatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_2011007095422log.xmpleasewait...progressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  11. Now the function is running.
  12. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\bzybty\documents\kl1tf4639cb000395_20110119153344iog.csvsucessfullycompleted,pressfinishlprogressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  13. After the message “Successfully completed, press finish” comes up, click “Finish”. The created XML file (see path) Dealer to send responsible Technical Assistance Center (or Help desk).
  14. serviceprogrammingsystemtransferdataserviceprogrammingsystem(sps)specialfunctioncaptureeculdentlflcatlondatalogfilec:\users\pmoh\documents\wolgm8ek9a1012345_dc_1_20110o7095422log.xmsucessfullycompleted,pressm4382:connectingtothesewer...vin:kl1tf4839cb000395
  15. Click “Finish”.
  16. serviceprogrammingsystem(sps)specialfunctioncontrolmoduleconfigurationandsetupfunction(s)pleaseselectoneormorefunctionsandpressthenextbuttonvehiclewidecaptureofecuidentificationdataspecialfunctionsessionlogvehiclewidecaptureofecuidentificationdata
  17. Click “Finish” to end the function.
BCM Reprogram


    Select Diagnostic Tool, Programming Process and click “Next”.serviceprogrammingsystemselectdiagnostictoolandprogrammingprocessselectdiagnostictoolj2534tech2j2534scan100j2534vectorpassthruxlubrarytech2legacypass-thrutech2remotetestdriverselectprogrammingprocess
  1. Select Diagnostic Tool, Programming Process and click “Next”.
  2. serviceprogrammingsystemj2534passthru:connectj2534devicetovehicleandpc:verifyvehiclebatteryfullycharged,engineoff,ignitionon.connectj2534devicetovehicle.connectj2534devicetopc.switchj2534deviceonandwaitfordevicetogetready.afterprogramming,thetechnicianwillbegiventheopportunitytocleardiagnostictroublecodesfromallecusonthisvehicle.thetechnicianmaywanttorecorddtcsandfreezeframedatabeforecontinuing.
  3. Click “Next”.
  4. serviceprogrammingsystemvalidate/selectvehicledatasalesmakechevroletvehicletypepassengergarserviceprogrammingsystemm4387:communicatingwiththedevice,pleasewait.
  5. Select Salesmake, Model Year, Vehicle Type, Car Line and click “Next”.
  6. serviceprogrammingsystemvalidatevehicleidentificationnumber(vin)makesurethatthecorrectvinisdisplayed.ifthevinisincorrectormissing,enterthevin.eumu-nrkl3ta48e9cboo2255upcomm:arrrnsnumsruninsunrun
  7. Verify correct VIN, click “Next”.
  8. serviceprogrammingsystemsupportedcontrollersselectcontrollerecuidentificationdatacontrolmoduleelectronicbrakecontrolmoduleenginecontrolmodulefrontseatheatingcontrolmodulefuelpumpcontrolmoduleimmobilizerlearninatablerestraintsensinganddiagnosticmoduleinstrumentclusterselectfunctionsequenceonrgurationsetuppreparecontrolmoduleforremovalselectprogrammingtypevin:kl3ta48e9cb002255data
  9. Select BCM in Controller and Programming in Function/Sequence.
  10. Select Programming Type.
  • “Normal” - (GMNA, South America & Australia)
  • “VCI” - (All Regions Except GMNA, South America and Australia)
Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA,serviceprogrammingsystemprogrammingbyvcientervalidvcinumberforthisvehicle.thevcimustbesuppliedbythecustomersupportcenter,andisonlyvalidforthisvin.donotentervciyouusedpreviouslyforanothervehicle.1234567890vin:kl3ta48e9cboo2255
  • Enter the V.C.I which is supplied by the SPS Team. (All regions except GMNA, South America and Australia) click “Next”.
  • serviceprogrammingsystemecusoftwareseectecusoftware35796891358262295932574959325989593260795474793959326329517403495932662959326749549036095932688954903919523369895040050vehicledatasalesmakeholdenmodelyear2012modelbarinaenine1.6llde
  • Confirm the ECU Software in TIS2WEB and Click “Next”.
  • serviceprogrammingsystemtransferdata1.downloadfromsewer2.loadtoecudownloadfromserverserverdownloadstatusestimatedtimeremainingdownload00meted0%loadecustatusestimatedtimeremainingfteprogramming...00:00:380%m4382:connectingtothesewer...vin:wolgb57h4910oob82
  • Programming in progress.
  • serviceprogrammingsystemj2534passthru:finalinstructionsprogrammingcomplete.warrantyclaimcode:40d7brecordthiscodeonthewarrantyrepairorder(ifapplicable).postprogramminginstructions:followthecontrollerspecificinstructionsbelow.iftherearenocontrollerspecificinstructions,turnignitionofffor30secondstoresetthecontroller.controllerspecificinstructions:clearingdtcswillerasestoredhistorydatafromallcontrollers,andwillresetthepcmi/mflags.pleaseperform:bodycontrolmoduleconfigurationsetupvin:wolgb57h491000882cleardtcscancel
  • Programming Complete.

    Note:

    After reprogramming the BCM, it may not recognize the brake pedal application & position. Delete all stored DTC’s after the reprogramming.

    Note:

    If the BAS Learning is not correctly completed; MDI GDS: Diagnostic>BCM>Reset Functions>”Brake Pedal Position Sensor Learn”.

  • Support Process


      Request BCM V.C.I by E-mail to regional TAC or other Help desk.tac/helpdesksupportdependson
    Electrical Power Management Description and Operation
    Electrical Power Management The electrical power management is used to monitor and control the charging system and alert the driver of possible problems within the charging system. The ...

    Generator Pulley Replacement (LUV)
    Generator Pulley Replacement Callout Component Name Preliminary Procedure Remove the generator. Refer to Generator Replacement. ...

    Other materials:

    Additional Factors Affecting System Operation
    Safety belts help keep the passenger in position on the seat during vehicle maneuvers and braking, which helps the passenger sensing system maintain the passenger airbag status. See “Safety Belts” and “Child Restraints” in the Index for additional information about the importance of pr ...

    Tire Pressure Light
    For vehicles with the Tire Pressure Monitor System (TPMS), this light comes on briefly when the engine is started. It provides information about tire pressures and the TPMS. When the Light Is On Steady This indicates that one or more of the tires are significantly underinflated. Stop as soo ...

    If No Steam Is Coming from the Engine Compartment
    If an engine overheat warning is displayed but no steam can be seen or heard, the problem may not be too serious. Sometimes the engine can get a little too hot when the vehicle: Climbs a long hill on a hot day. Stops after high-speed driving. Idles for long periods in traffic. If the ...

    © 2014-2020 Copyright www.csmans.com
       
    0.0127